PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_1589g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 452aa    MW: 51142.8 Da    PI: 6.0994
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_1589g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++  G g+W+ ++++ g+ R++k+c++rw +yl
     MA_1589g0010 14 RGLWSPEEDEKLINYINNNGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding55.21.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE++l++ +++  G++ W+ Ia +++ gRt++++k++w+++
     MA_1589g0010  67 RGKFTPEEEKLIISLHNIVGNR-WAHIATHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.423961IPR017930Myb domain
SuperFamilySSF466893.03E-2911108IPR009057Homeodomain-like
SMARTSM007173.3E-111363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-241568IPR009057Homeodomain-like
CDDcd001672.74E-101761No hitNo description
PROSITE profilePS5129426.05162116IPR017930Myb domain
SMARTSM007172.8E-1766114IPR001005SANT/Myb domain
PfamPF002491.6E-1667111IPR001005SANT/Myb domain
CDDcd001676.98E-1369112No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2569116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLINYIN NNGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPNIRRGKF TPEEEKLIIS LHNIVGNRWA HIATHLPGRT DNEIKNYWNS WIKKKLARSR  120
FDSKLLAEQN PTGPELSQIL SKQVNTVEDE SIIYTTYSND HSPQTQLYMA GNSLQQTVSN  180
QKQDSKMSEA LGHCNISNDH ASSASMMDKT LYSIYQKNGK SNLESFVHDH KGASDSDSEL  240
AALAHDSVYI APCSQPSLEY NNENLNIAGK RIDQYADQHR DLQAPKNGIP TGYNNTGELS  300
HIASTTVASE MPATTSFPFQ NICKNDAMPL LPAILSDYCS LSIQAGSDQH AQSCNYLPQL  360
LEHGEDWAAN YSMKYSSNGV SRTVDEIQIP ILSNHKDQFP ELSIDERESY MNSSLQWYEV  420
PHSFFHLEHL NDGMESMESI SPPYGYVDRQ LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26141167108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-77myb domain protein 103